PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G04660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 262aa    MW: 27828.1 Da    PI: 8.7621
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G04660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.64e-152471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+  ++++G  +W++++   g+ R++k+c++rw +yl
  ORUFI01G04660.1 24 KGLWSPEEDERLATHIARFGVSCWSSVPDLAGLQRCGKSCRLRWMNYL 71
                     678*******************************************97 PP

2Myb_DNA-binding46.68e-1577119145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rgr++  E+el++ ++ +lG+  W+ Ia++++ gR+++++k++w+
  ORUFI01G04660.1  77 RGRFSHHEEELILALHDKLGNS-WSQIAARLP-GRSDNEIKNFWN 119
                      89******************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-221874IPR009057Homeodomain-like
PROSITE profilePS5129415.9721971IPR017930Myb domain
SuperFamilySSF466893.33E-2722118IPR009057Homeodomain-like
SMARTSM007179.3E-112373IPR001005SANT/Myb domain
PfamPF002496.8E-142471IPR001005SANT/Myb domain
CDDcd001673.57E-92771No hitNo description
PROSITE profilePS5129423.92472126IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.9E-2575126IPR009057Homeodomain-like
SMARTSM007177.9E-1476124IPR001005SANT/Myb domain
PfamPF002498.6E-1377119IPR001005SANT/Myb domain
CDDcd001672.83E-979119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MIMGRAVEQQ QGGCCSEKKK KLRKGLWSPE EDERLATHIA RFGVSCWSSV PDLAGLQRCG  60
KSCRLRWMNY LRPDLKRGRF SHHEEELILA LHDKLGNSWS QIAARLPGRS DNEIKNFWNA  120
RLRKKLRQTE SSSSATTAAG AAATGHRRGE ADRSRPPPPA SFNTFSHDDR TTPAPAAHIA  180
AAAAVEAPAA MTTTGGAVGG GVLVDNSGGH RDAVAEAARG HVGSGDDDGF LAVLLGEYYL  240
DAGGHGDGFS FLGGGGGGHV FS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-262212625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120126RLRKKLR
2121127LRKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0029120.0AP002912.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0028E10.
GenBankAP0033390.0AP003339.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OJ1276_B06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643964.10.0PREDICTED: myb-related protein Hv33-like
TrEMBLA0A0E0MRW70.0A0A0E0MRW7_ORYRU; Uncharacterized protein
STRINGLOC_Os01g07450.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144481725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-57myb domain protein 86